Species: Human

Host Species/Expression System: E.coli

Molecular weight: 6.2 kDa

Purity: ≥ 95 % by SDS-PAGE analysis

Format: Lyophilized protein

Amino acid sequence:

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Biological Activity: ED50 is < 0.5 ng/ml. ED50 was determined by a cell proliferation (assay using BALB/c 3T3 cells)

Formulation: 20 mM Sodium phosphate, pH 7.0 with sucrose.

Storage condition: Store the lyophilized protein at -20℃ to -80℃ for lone term. 

After reconstitution, the protein solution is stable at -20℃ for 3 month, at 2-8℃ for up to 1 week. Avoid repeated freeze/thaw cycles.

Description:

    Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. EGF is a 6,200 Da protein containing 53 amino acid residues.

Reconstitution：

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile PBS buffer. Stock solutions should be apportioned into working aliquots and store at ≤ -20℃. Future dilutions should be made in appropriate buffered solution